Killer Cell Immunoglobulin-Like Receptor 2DS3, Recombinant, Human, aa22-245, His-Tag (KIR2DS3)

Produktübersicht

• Artikelname: Killer Cell Immunoglobulin-Like Receptor 2DS3, Recombinant, Human, aa22-245, His-Tag (KIR2DS3)
• Artikelnummer: USB-517978
• Hersteller Artikelnummer: 517978
• Alternativnummer: USB-517978-20,USB-517978-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells. Partial recombinant protein corresponding to aa22-245 of human Killer Cell Immunoglobulin-Like Receptor 2DS3, fused to 6xHis-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~26.7kD Amino Acid Sequence: HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 26.7
• UniProt: Q14952
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.