Lymphocyte Antigen 6 Complex Locus Protein G6d, Recombinant, Human, aa20-104, His-B2M-Tag (LY6G6D)

Produktübersicht

• Artikelname: Lymphocyte Antigen 6 Complex Locus Protein G6d, Recombinant, Human, aa20-104, His-B2M-Tag (LY6G6D)
• Artikelnummer: USB-517986
• Hersteller Artikelnummer: 517986
• Alternativnummer: USB-517986-20,USB-517986-100,USB-517986-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa20-104 of human Lymphocyte Antigen 6 Complex Locus Protein G6d, fused to 10xHis-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~25.5kD Amino Acid Sequence: NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 25.5
• UniProt: O95868
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.