Main Hemagglutinin Component, Recombinant, Clostridium Botulinum, aa2-286, His-Sumo-Tag, Myc-Tag (HA-33)

Produktübersicht

• Artikelname: Main Hemagglutinin Component, Recombinant, Clostridium Botulinum, aa2-286, His-Sumo-Tag, Myc-Tag (HA-33)
• Artikelnummer: USB-517991
• Hersteller Artikelnummer: 517991
• Alternativnummer: USB-517991-20,USB-517991-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Protects the structural integrity of the neurotoxin, may increase internalization of the neurotoxin into the bloodstream of the host. Involved in binding to the small intestine through interactions with glycolipids and glycoproteins containing sialic acid moieties. Source: Recombinant protein corresponding to aa2-286 of Clostridium Botulinum Main Hemagglutinin Component, fused to 6xHis-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~53.6kD Amino Acid Sequence: SQTNANDLRNNEVFFISPSNNTNKVLDKISQSEVKLWNKLSGANQKWRLIYDTNKQAYKIKVMDNTSLILTWNAPLSSVSVKTDTNGDNQYWYLLQNYISRNVIIRNYMNPNLVLQYNIDDTLMVSTQTSSSNQFFKFSNCIYEALNNRNCKLQTQLNSDRFLSKNLNSQIIVLWQWFDSSRQKWIIEYNETKSAYTLKCQENNRYLTWIQNSNNYVETYQSTDSLIQYWNINYLDNDASKYILYNLQDTNRVLDVYNSQIANGTHVIVDSYHGNTNQQWIINLI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 53.6
• UniProt: P46084
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.