Nitrogenase Iron Protein, Recombinant, Rhizobium Leguminosarum, aa1-47, His-GST-Tag, Myc-Tag (nifH)

Artikelnummer: USB-518020
Artikelname: Nitrogenase Iron Protein, Recombinant, Rhizobium Leguminosarum, aa1-47, His-GST-Tag, Myc-Tag (nifH)
Artikelnummer: USB-518020
Hersteller Artikelnummer: 518020
Alternativnummer: USB-518020-20,USB-518020-200
Hersteller: US Biological
Kategorie: Molekularbiologie
The key enzymatic reactions in nitrogen fixation are catalyzed by the nitrogenase complex, which has 2 components: the iron protein and the molybdenum-iron protein. Source: Recombinant full length protein corresponding to aa1-47 of Rhizobium Leguminosarum Nitrogenase Iron Protein, fused to 10xHis-GST-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~35kD Amino Acid Sequence: MAALRQIAFYGKGGIGKSTTSQNTLAALVDHHVPRIPMIIRIGGYAQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 35
UniProt: P20623
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.