Outer Membrane Protein C, Recombinant, E. coli, aa22-367 (ompC)

Artikelnummer: USB-518039
Artikelname: Outer Membrane Protein C, Recombinant, E. coli, aa22-367 (ompC)
Artikelnummer: USB-518039
Hersteller Artikelnummer: 518039
Alternativnummer: USB-518039-20
Hersteller: US Biological
Kategorie: Molekularbiologie
Forms pores that allow passive diffusion of small molecules across the outer membrane. Recombinant protein corresponding to aa22-367 of E. coli Outer Membrane Protein C, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.3kD Amino Acid Sequence: AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 38.3
UniProt: P06996
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.