Oxalate Oxidase 1, Recombinant, Hordeum Vulgare, aa1-20, His-Tag, Myc-Tag

Artikelnummer: USB-518040
Artikelname: Oxalate Oxidase 1, Recombinant, Hordeum Vulgare, aa1-20, His-Tag, Myc-Tag
Artikelnummer: USB-518040
Hersteller Artikelnummer: 518040
Alternativnummer: USB-518040-20,USB-518040-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Releases hydrogen peroxide in the apoplast which may be important for cross-linking reactions in the cell wall biochemistry. May play an important role in several aspects of plant growth and defense mechanisms. Source: Recombinant full length protein corresponding to aa1-20 of Hordeum Vulgare Oxalate Oxidase 1, fused to 10xHis-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~28.2kD Amino Acid Sequence: SDPDPLQDFCVADLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAGGS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 28.2
UniProt: P45850
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.