Pregnancy-Associated Protein bPAP, Recombinant, Bovine, aa1-100, His-Tag, Myc-Tag
Artikelnummer:
USB-518061
Hersteller Artikelnummer:
518061
Alternativnummer:
USB-518061-20,USB-518061-100
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Detected at high levels in the urine of pregnant females (at protein level) and at far lower levels in the urine of nonpregnant females. Source: Recombinant full length protein corresponding to aa1-100 of bovine Pregnancy-Associated Protein bPAP, fused to 10xHis-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~17.3kD Amino Acid Sequence: DSELAGPRGARGPHGLSGPHGLSGLSGPSGYTGPIGMSGLTGLRREESEKVWLESKDGQELELVSSGSAQEELELVSSGSAQVSFASYLGASQPLPSELW Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten