Probable Endo-Beta-1,4-Glucanase D, Recombinant, Aspergillus Kawachii, aa21-408, His-Sumostar-Tag (eglD)

Artikelnummer: USB-518065
Artikelname: Probable Endo-Beta-1,4-Glucanase D, Recombinant, Aspergillus Kawachii, aa21-408, His-Sumostar-Tag (eglD)
Artikelnummer: USB-518065
Hersteller Artikelnummer: 518065
Alternativnummer: USB-518065-20,USB-518065-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Has endoglucanase activity on substrates containing beta-1,4 glycosidic bonds, like in carboxymethylcellulose (CMC), hydroxyethylcellulose (HEC) and beta-glucan. Involved in the degradation of complex natural cellulosic substrates. Recombinant protein corresponding to aa21-408 of Aspergillus Kawachii Probable Endo-Beta-1,4-Glucanase D, fused to 6X His-Sumostar-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~55.7kD AA Sequence: HTTVQAVWINGEDQGLGNTDDGYIRSPPSNSPVTDVTSTDMTCNVNGDQAASKTLSVKAGDVVTFEWHHSDRSDSDDIIASSHKGPVQVYMAPTAKGSNGNNWVKIAEDGYHKSSDEWATDILIANKGKHNITVPDVPAGNYLFRPEIIALHEGNREGGAQFYMECVQFKVTSDGSNELPSGVSIPGVYTATDPGILFDIYNSFDSYPIPGPDVWDGSSSGSSSSGSSSAAVSSAAAAATTSAVAATTPATQAAVEVSSSAAAATTEAAAPVVSSAAPVQQATSAVTSQAQAAPTTFATSSKKSSKTACKNKTKSNSQVAAATSSVVAPAATSSVVPVVSASASASAGGVAKQYERCGGINHTGPTTCESGSVCKKWNPYYYQCVASQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 55.7
UniProt: Q96WQ9
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.