Protease 7, Recombinant, E. coli, aa21-317, His-Sumo-Tag (OmpT)

Artikelnummer: USB-518070
Artikelname: Protease 7, Recombinant, E. coli, aa21-317, His-Sumo-Tag (OmpT)
Artikelnummer: USB-518070
Hersteller Artikelnummer: 518070
Alternativnummer: USB-518070-20,USB-518070-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Protease that can cleave T7 RNA polymerase, ferric enterobactin receptor protein (FEP), antimicrobial peptide protamine and other proteins. This protease has a specificity for paired basic residues. Source: Recombinant protein corresponding to aa21-317 of E. coli Protease 7, fused to 6xHis-Sumo-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~49.5kD Amino Acid Sequence: STETLSFTPDNINADISLGTLSGKTKERVYLAEEGGRKVSQLDWKFNNAAIIKGAINWDLMPQISIGAAGWTTLGSRGGNMVDQDWMDSSNPGTWTDESRHPDTQLNYANEFDLNIKGWLLNEPNYRLGLMAGYQESRYSFTARGGSYIYSSEEGFRDDIGSFPNGERAIGYKQRFKMPYIGLTGSYRYEDFELGGTFKYSGWVEASDNDEHYDPKGRITYRSKVKDQNYYSVSVNAGYYVTPNAKVYVEGTWNRVTNKKGNTSLYDHNDNTSDYSKNGAGIENYNFITTAGLKYTF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 49.5
UniProt: P58603
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.