Proteasome Subunit Beta Type-8, Recombinant, Human, aa73-276, His-Sumo-Tag, Myc-Tag (PSMB8)

Artikelnummer: USB-518071
Artikelname: Proteasome Subunit Beta Type-8, Recombinant, Human, aa73-276, His-Sumo-Tag, Myc-Tag (PSMB8)
Artikelnummer: USB-518071
Hersteller Artikelnummer: 518071
Alternativnummer: USB-518071-20,USB-518071-100,USB-518071-1
Hersteller: US Biological
Kategorie: Molekularbiologie
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. Replacement of PSMB5 by PSMB8 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues. Acts as a major component of interferon gamma-induced sensitivity. Plays a key role in apoptosis via the degradation of the apoptotic inhibitor MCL1. May be involved in the inflammatory response pathway. In cancer cells, substitution of isoform 1 (E2) by isoform 2 (E1) results in immunoproteasome deficiency. Required for the differentiation of preadipocytes into adipocytes. Source: Recombinant protein corresponding to aa1-505 of human Peroxisome Proliferator-Activated Receptor Gamma, fused to 10xHis-Sumo-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~42.7kD Amino Acid Sequence: TTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 42.7
UniProt: P28062
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.