Protein E3, Recombinant, Vaccinia Virus, aa1-190, His-Tag, Myc-Tag (E3L)

Produktübersicht

• Artikelname: Protein E3, Recombinant, Vaccinia Virus, aa1-190, His-Tag, Myc-Tag (E3L)
• Artikelnummer: USB-518072
• Hersteller Artikelnummer: 518072
• Alternativnummer: USB-518072-20,USB-518072-200
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

The C-terminal binds to and sequesters double-stranded RNA (dsRNA) synthesized during viral infection. This binding acts to mask the dsRNA thereby preventing recognition and subsequent activation of EIF2AK2/PKR. The N-terminal is required for phosphorylation regulation of the translation initiation factor EIF2S1, but without affecting cytosolic protein translation. Blocks the phosphorylation and subsequent activation of IRF3 and IRF7 kinases, that are required for interferon-alpha (IFN-alpha) gene expression. Also inhibits NF-kappa-B activation and the ubiquitin-like protein G1P2/ISG15, which is an early antiviral protein. Source: Recombinant full length protein corresponding to aa1-190 of Vaccinia Virus Protein E3, fused to 10xHis-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~28.5kD Amino Acid Sequence: MSKIYIDERSDAEIVCAAIKNIGIEGATAAQLTRQLNMEKREVNKALYDLQRSAMVYSSDDIPPRWFMTTEADKPDADAMADVIIDDVSREKSMREDHKSFDDVIPAKKIIDWKDANPVTIINEYCQITKRDWSFRIESVGPSNSPTFYACVDIDGRVFDKADGKSKRDAKNNAAKLAVDKLLGYVIIRF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 28.5
• UniProt: P21081
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.