Sarcoplasmic Calcium-Binding Protein, Alpha-B and -A Chains, Recombinant, Penaeus sp., aa1-1192, His-Sumo-Tag, Myc-Tag

Produktübersicht

• Artikelname: Sarcoplasmic Calcium-Binding Protein, Alpha-B and -A Chains, Recombinant, Penaeus sp., aa1-1192, His-Sumo-Tag, Myc-Tag
• Artikelnummer: USB-518097
• Hersteller Artikelnummer: 518097
• Alternativnummer: USB-518097-20,USB-518097-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Like parvalbumins, SCPs seem to be more abundant in fast contracting muscles, but no functional relationship can be established from this distribution. Source: Recombinant full length protein corresponding to aa1-192 of Penaeus sp. Sarcoplasmic Calcium-Binding Protein, Alpha-B and -A Chains, fused to 10xHis-Sumo-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~42kD Amino Acid Sequence: AYSWDNRVKYVVRYMYDIDDDGFLDKNDFECLAVRNTLIEGRGEFSAADYANNQKIMRNLWNEIAELADFNKDGEVTVDEFKMAVQKHCQGKKYSEFPGAFKVFIANQFKAIDVNGDGKVGLDEYRLDCITRSAFAEVKEIDDAYDKLTTEDDRKAGGLTLERYQDLYAQFISNPNESCSACFLFGPLKVVQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 42
• UniProt: P02636
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.