Secreted Frizzled-Related Protein 5, Recombinant, Mouse, aa22-314, His-Tag (SFRP5)

Produktübersicht

• Artikelname: Secreted Frizzled-Related Protein 5, Recombinant, Mouse, aa22-314, His-Tag (SFRP5)
• Artikelnummer: USB-518101
• Hersteller Artikelnummer: 518101
• Alternativnummer: USB-518101-20,USB-518101-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP5 may be involved in determining the polarity of photoreceptor, and perhaps, other cells in the retina. Source: Recombinant protein corresponding to aa22-314 of mouse Secreted Frizzled-Related Protein 5, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~37.2kD Amino Acid Sequence: APTRGQEYDYYGWQAEPLHGRSYSKPPQCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRPIYPCRSLCEAARAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIDNGDRKLIGAQKKKKLLKAGPLKRKDTKKLVLHMKNGASCPCPQLDNLTGSFLVMGRKVEGQLLLTAVYRWDKKNKEMKFAVKFMFSYPCSLYYPFFYGAAEPH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 37.2
• UniProt: Q9WU66
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.