Serum Amyloid A Protein, Recombinant, Equine, aa1-110, His-Tag (SAA1)

Artikelnummer: USB-518111
Artikelname: Serum Amyloid A Protein, Recombinant, Equine, aa1-110, His-Tag (SAA1)
Artikelnummer: USB-518111
Hersteller Artikelnummer: 518111
Alternativnummer: USB-518111-20,USB-518111-200
Hersteller: US Biological
Kategorie: Molekularbiologie
Major acute phase reactant. Apolipoprotein of the HDL complex. Source: Recombinant full length protein corresponding to aa1-110 of equine Serum Amyloid A Protein, fused to 10xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.8kD Amino Acid Sequence: LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFHARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRFSFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHGLPDKY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 15.8
UniProt: P19857
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.