Trypsin-4, Recombinant, Rat, aa24-247, His-Tag (Try4)

Produktübersicht

• Artikelname: Trypsin-4, Recombinant, Rat, aa24-247, His-Tag (Try4)
• Artikelnummer: USB-518139
• Hersteller Artikelnummer: 518139
• Alternativnummer: USB-518139-20,USB-518139-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa. Source: Recombinant protein corresponding to aa24-247 of rat Trypsin-4, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.6kD Amino Acid Sequence: IVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHCYKRKLQVRLGEHNIHVLEGGEQFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSLPRSCASTDAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFCLGFLEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQETMANN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 29.6
• UniProt: P12788
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.