Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Isoleucine-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family and has been identified as a target of autoantibodies in the autoimmune disease polymyositis/dermatomyositis. Two alternatively spliced variants have been isolated that represent alternate 5 UTRs. [provided by RefSeq] Source: Recombinant protein corresponding to aa1172-1262 from human IARS, fused to Gst-tag at N-terminal. Sequencxe: QYINLQLLNAKPQECLMGTVGTLLLENPLGQNGLTHQGLLYEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTADF Entrez GeneID: 3376 Gene Symbol: IARS Gene Alias: FLJ20736, IARS1, ILRS, PRO0785 Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Host: Wheat Germ (in vitro) Theoretical MW (kD): 35.75 Preparation Method: In vitro wheat germ expression system Purification: Glutathione Sepharose 4 Fast Flow Quality Control: 12.5% SDS-PAGE Stained with Coomassie Blue. Storage and Stability: Aliquot to avoid repeated freezing and thawing. Store at -70C. Aliquots are stable for 3-6 months after receipt at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molekulargewicht:
35.75
UniProt:
NP_038203.1
Reinheit:
Glutathione Sepharose 4 Fast Flow
Formulierung:
50mM Tris-HCI, 10mM reduced Glutathione, pH 8.0 in the elution buffer.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten