1,3-beta-glucanosyltransferase gel4, Recombinant, Neosartorya Fumigata, aa26-519, His-Tag

Artikelnummer: USB-583360
Artikelname: 1,3-beta-glucanosyltransferase gel4, Recombinant, Neosartorya Fumigata, aa26-519, His-Tag
Artikelnummer: USB-583360
Hersteller Artikelnummer: 583360
Alternativnummer: USB-583360-20,USB-583360-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Splits internally a 1,3-beta-glucan molecule and transfers the newly generated reducing end (the donor) to the non-reducing end of another 1,3-beta-glucan molecule (the acceptor) forming a 1,3-beta linkage, resulting in the elongation of 1,3-beta-glucan chains in the cell wall. Involved in cell wall morphogenesis. Source: Recombinant protein corresponding to aa26-519 from Neosartorya fumigata 1,3-beta-glucanosyltransferase gel4, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~55.4kD Amino Acid Sequence: KVLKACCWTIALDANSYGNKFFYSNNGTEFFIRGVAYQQEYQANGTSTENSDYTDPLANVDNCKRDIPYLKQLRTNVIRTYAVDPTKDHDECMKLLDDAGIYLITDLSAPSESINRADPAWNTDLYKRYTSVIDAFAKYSNVIGFFAGNEVANDNNNTNSIAYVKAAVRDMKSYIKSKDYRSSLLVGYATDDDAHIRADLADYLVCGDKESSIDMFGYNIYEWCGDSSFEKSGYKDRTEEFSKYPVPAFFSEYGCIDPKPRKFTDVAALYGPQMNDVWSGGIVYMYFQEANDYGLVSVSGDNVKTKEDFSYLSVQMQKVTATGVNSASYTASNTAVPTCPSVGAKWEASNKLPPSPNSELCDCMVETLSCTVKDSVDEKEYGDLFDYLCAAGVCGGINSNSTSGDYGAYSVCSAKQKLSFVMNQYYKKNNKAATACDFDGKAQTKKGADASGSCASLISQAGTAGTGSVTAGATGSSGSGSASETSKGAAGVAA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 55.4
UniProt: P0C956
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.