14kD Fusion Protein, Recombinant, Vaccinia virus, aa1-110, His-Tag, Myc-Tag

Artikelnummer: USB-583366
Artikelname: 14kD Fusion Protein, Recombinant, Vaccinia virus, aa1-110, His-Tag, Myc-Tag
Artikelnummer: USB-583366
Hersteller Artikelnummer: 583366
Alternativnummer: USB-583366-20,USB-583366-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion. Source: Recombinant protein corresponding to aa1-110 from Vaccinia virus 14kD fusion protein, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~19.6kD Amino Acid Sequence: MDGTLFPGDDDLAIPATEFFSTKADKKPEAKREAIVKADEDDNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 19.6
UniProt: P20535
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.