14kD Fusion Protein, Recombinant, Variola virus, aa1-110, His-Tag

Artikelnummer: USB-583368
Artikelname: 14kD Fusion Protein, Recombinant, Variola virus, aa1-110, His-Tag
Artikelnummer: USB-583368
Hersteller Artikelnummer: 583368
Alternativnummer: USB-583368-20,USB-583368-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion. Source: Recombinant protein corresponding to aa1-110 from Variola virus 14kD fusion protein, fused to 6X His-Tag at N-terminal, expressed in Mammalian cell. Molecular Weight: ~16.5kD Amino Acid Sequence: MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 16.5
UniProt: P33816
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.