2-Cys Peroxiredoxin BAS1, Chloroplastic, Recombinant, Arabidopsis thaliana, aa66-266, His-Tag, Myc-Tag

Artikelnummer: USB-583380
Artikelname: 2-Cys Peroxiredoxin BAS1, Chloroplastic, Recombinant, Arabidopsis thaliana, aa66-266, His-Tag, Myc-Tag
Artikelnummer: USB-583380
Hersteller Artikelnummer: 583380
Alternativnummer: USB-583380-20,USB-583380-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. May be an antioxidant enzyme particularly in the developing shoot and photosynthesizing leaf. Source: Recombinant protein corresponding to aa66-266 from Arabidopsis thaliana 2-Cys peroxiredoxin BAS1, chloroplastic, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Yeast. Molecular Weight: ~26.4kD Amino Acid Sequence: KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 26.4
UniProt: Q96291
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.