26kD Secreted Antigen, Recombinant, Toxocara Canis, aa22-262, His-Tag

Artikelnummer: USB-583385
Artikelname: 26kD Secreted Antigen, Recombinant, Toxocara Canis, aa22-262, His-Tag
Artikelnummer: USB-583385
Hersteller Artikelnummer: 583385
Alternativnummer: USB-583385-20, USB-583385-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Binds phosphatidylethanolamine. Recombinant protein corresponding to aa22-262 from Toxocara canis 26kD secreted antigen, fused to 9X His-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~27.9kD Amino Acid Sequence: QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 27.9
UniProt: P54190
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.