3-demethoxyubiquinol 3-hydroxylase, Recombinant, E. coli, aa1-391, His-Tag

Produktübersicht

• Artikelname: 3-demethoxyubiquinol 3-hydroxylase, Recombinant, E. coli, aa1-391, His-Tag
• Artikelnummer: USB-583392
• Hersteller Artikelnummer: 583392
• Alternativnummer: USB-583392-20,USB-583392-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Catalyzes the hydroxylation of 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol during ubiquinone biosynthesis. Source: Recombinant protein corresponding to aa1-391 from Escherichia coli 3-demethoxyubiquinol 3-hydroxylase, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~46.5kD Amino Acid Sequence: MTNQPTEIAIVGGGMVGGALALGLAQHGFAVTVIEHAEPAPFVADSQPDVRISAISAASVSLLKGLGVWDAVQAMRCHPYRRLETWEWETAHVVFDAAELKLPLLGYMVENTVLQQALWQALEAHPKVTLRVPGSLIALHRHDDLQELELKGGEVIRAKLVIGADGANSQVRQMAGIGVHAWQYAQSCMLISVQCENDPGDSTWQQFTPDGPRAFLPLFDNWASLVWYDSPARIRQLQNMNMAQLQAEIAKHFPSRLGYVTPLAAGAFPLTRRHALQYVQPGLALVGDAAHTIHPLAGQGVNLGYRDVDALIDVLVNARSYGEAWASYPVLKRYQMRRMADNFIMQSGMDLFYAGFSNNLPPLRFMRNLGLMAAERAGVLKRQALKYALGL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 46.5
• UniProt: P75728
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.