3-demethoxyubiquinol 3-hydroxylase, Recombinant, E. coli, aa1-391, His-Tag
Artikelnummer:
USB-583392
Hersteller Artikelnummer:
583392
Alternativnummer:
USB-583392-20, USB-583392-100
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Catalyzes the hydroxylation of 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol during ubiquinone biosynthesis. Source: Recombinant protein corresponding to aa1-391 from Escherichia coli 3-demethoxyubiquinol 3-hydroxylase, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~46.5kD Amino Acid Sequence: MTNQPTEIAIVGGGMVGGALALGLAQHGFAVTVIEHAEPAPFVADSQPDVRISAISAASVSLLKGLGVWDAVQAMRCHPYRRLETWEWETAHVVFDAAELKLPLLGYMVENTVLQQALWQALEAHPKVTLRVPGSLIALHRHDDLQELELKGGEVIRAKLVIGADGANSQVRQMAGIGVHAWQYAQSCMLISVQCENDPGDSTWQQFTPDGPRAFLPLFDNWASLVWYDSPARIRQLQNMNMAQLQAEIAKHFPSRLGYVTPLAAGAFPLTRRHALQYVQPGLALVGDAAHTIHPLAGQGVNLGYRDVDALIDVLVNARSYGEAWASYPVLKRYQMRRMADNFIMQSGMDLFYAGFSNNLPPLRFMRNLGLMAAERAGVLKRQALKYALGL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten