37kD Salivary Gland Allergen Aed a 2, Recombinant, Aedes aegypti, aa18-321, His-Tag

Artikelnummer: USB-583416
Artikelname: 37kD Salivary Gland Allergen Aed a 2, Recombinant, Aedes aegypti, aa18-321, His-Tag
Artikelnummer: USB-583416
Hersteller Artikelnummer: 583416
Alternativnummer: USB-583416-20,USB-583416-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Thought to be involved in blood-feeding. Source: Recombinant protein corresponding to aa18-321 from Aedes aegypti 37kD salivary gland allergen Aed a 2, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~37.1kD Amino Acid Sequence: STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTGLYDPVAQKFDASVIQEQFKAYPSLGEKSKVEAYANAVQQLPSTNNDCAAVFKAYDPVHKAHKDTSKNLFHGNKELTKGLYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCKIRQYTVLDDALFKEHTDCVMKGIRYITKNNELDAEEVKRDFMQVNKDTKALEKVLNDCKSKEPSNAGEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYAFNLPKKQVYSKPAVQSQVMEIDGKQCPQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 37.1
UniProt: P18153
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.