4-phosphopantetheinyl Transferase ffp, Recombinant, Bacillus subtilis, aa1-224, His-Tag, Myc-Tag

Artikelnummer: USB-583417
Artikelname: 4-phosphopantetheinyl Transferase ffp, Recombinant, Bacillus subtilis, aa1-224, His-Tag, Myc-Tag
Artikelnummer: USB-583417
Hersteller Artikelnummer: 583417
Alternativnummer: USB-583417-20,USB-583417-100
Hersteller: US Biological
Kategorie: Molekularbiologie
May activate the peptidyl carrier protein (PCP) domains of fengycin synthase by transferring the 4-phosphopantetheinyl moiety of coenzyme A (CoA) to a serine residue. Source: Recombinant protein corresponding to aa1-224 from Bacillus subtilis 4-phosphopantetheinyl transferase ffp, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~31.0kD Amino Acid Sequence: MKIYGIYMDRPLSQEETDRLMSFVSAEKREKCRRFYHKEDAHRTLLGDVLVRSVISEQYQLNKADIRFSAQEYGKPCIPDLPNAHFNISHSGHWVIGAFDSDPIGVDIEKMKPISLGIAERFFSKNEYSDLLSKHKDEQNDYFYHLWSMKESFIKQEGKGLSLPLDSFSVRLHEDGRVSVELPEHHTPCFIKTYEVDPGYKMAVCAARPDFPEDITMISYEALL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 31
UniProt: Q9F4F7
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.