5-hydroxytryptamine Receptor 1D, Recombinant, Human, aa1-38, hFc-Tag

Artikelnummer: USB-583436
Artikelname: 5-hydroxytryptamine Receptor 1D, Recombinant, Human, aa1-38, hFc-Tag
Artikelnummer: USB-583436
Hersteller Artikelnummer: 583436
Alternativnummer: USB-583436-20,USB-583436-100
Hersteller: US Biological
Kategorie: Molekularbiologie
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for ergot alkaloid derivatives, various anxiolytic and antidepressant drugs and other psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity. Regulates the release of 5-hydroxytryptamine in the brain, and thereby affects neural activity. May also play a role in regulating the release of other neurotransmitters. May play a role in vasoconstriction. Partial recombinant protein corresponding to aa1-38 from human 5-hydroxytryptamine receptor 1D, fused to hFc-Tag at C-terminal, expressed in Mammalian cell. Swiss/Uniprot: P28221 Molecular Weight: ~33.1kD Amino Acid Sequence: MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 33.1
UniProt: P28221
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.