5-hydroxytryptamine Receptor 3E, Recombinant, Human, aa72-228, aa241-456, His-SUMO-Tag

Artikelnummer: USB-583440
Artikelname: 5-hydroxytryptamine Receptor 3E, Recombinant, Human, aa72-228, aa241-456, His-SUMO-Tag
Artikelnummer: USB-583440
Hersteller Artikelnummer: 583440
Alternativnummer: USB-583440-20,USB-583440-100
Hersteller: US Biological
Kategorie: Molekularbiologie
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel. Recombinant protein corresponding to aa72-228, aa241-456 from human 5-hydroxytryptamine receptor 3E, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~58.2kD Amino Acid Sequence: MSAILDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNLWLPDIFIIELMDVDKTPKGLTAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITDASRNILQTHGEWELLGLSKATAKLSRVAIRRRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVPFKITLLLGYNVFLLMMSDLLPTSGTPLIGVYFALCLSLMVGSLLETIFITHLLHVATTQPPPLPRWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPGPAEAELTGGSEWTRAQREHEAQKQHSVELWLQFSHAMDAMLFRLYLLFMASSIITVICLWNT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 58.2
UniProt: A5X5Y0
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.