A Disintegrin and Metalloproteinase with Thrombospondin Motifs 13, Recombinant, Mouse, aa904-1137, His-Tag, Myc-Tag

Artikelnummer: USB-583458
Artikelname: A Disintegrin and Metalloproteinase with Thrombospondin Motifs 13, Recombinant, Mouse, aa904-1137, His-Tag, Myc-Tag
Artikelnummer: USB-583458
Hersteller Artikelnummer: 583458
Alternativnummer: USB-583458-20,USB-583458-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Cleaves the vWF multimers in plasma into smaller forms thereby controlling vWF-mediated platelet thrombus formation. Source: Recombinant protein corresponding to aa904-1137 from mouse A disintegrin and metalloproteinase with thrombospondin motifs 13, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~32.7kD Amino Acid Sequence: WTPLVGLCSISCGRGLKELYFLCMDSVLKMPVQEELCGLASKPPSRWEVCRARPCPARWETQVLAPCPVTCGGGRVPLSVRCVQLDRGHPISVPHSKCSPVPKPGSFEDCSPEPCPARWKVLSLGPCSASCGLGTATQMVACMQLDQGHDNEVNETFCKALVRPQASVPCLIADCAFRWHISAWTECSVSCGDGIQRRHDTCLGPQAQVPVPANFCQHLPKPMTVRGCWAGPCA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 32.7
UniProt: Q769J6
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.