Accessory Factor US11, Recombinant, Human herpesvirus 1, aa1-161, His-Tag, Myc-Tag

Artikelnummer: USB-583468
Artikelname: Accessory Factor US11, Recombinant, Human herpesvirus 1, aa1-161, His-Tag, Myc-Tag
Artikelnummer: USB-583468
Hersteller Artikelnummer: 583468
Alternativnummer: USB-583468-20,USB-583468-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays a role in the inhibition of host immune response. Participates in the inhibition of host autophagy by interacting with and inhibiting host PKR/EIF2AK2. This interaction also prevents the interferon-induced shut down of protein synthesis following viral infection. Downmodulates the host RLR signaling pathway via direct interaction with host DDX58 and IFIH1. Associates with endogenous HSP90 to disrupt the HSP90-TBK1 complex and induces destabilization of host TBK1 through a proteasome-dependent pathway. May also participate in nuclear egress of viral particles through interactions with host NCL and regulation of the viral UL34 mRNA. Source: Recombinant protein corresponding to aa1-161 from Human herpesvirus 1 Accessory factor US11, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~25.2kD Amino Acid Sequence: MSQTQPPAPVGPGDPDVYLKGVPSAGMHPRGVHAPRGHPRMISGPPQRGDNDQAAGQCGDSGLLRVGADTTISKPSEAVRPPTIPRTPRVPREPRVPRPPREPREPRVPRAPRDPRVPRDPRDPRQPRSPREPRSPREPRSPREPRTPRTPREPRTARGSV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 25.2
UniProt: P04487
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.