Acetylcholine Receptor Subunit Alpha, Recombinant, Human, aa21-255, His-PDI-Tag

Artikelnummer: USB-583479
Artikelname: Acetylcholine Receptor Subunit Alpha, Recombinant, Human, aa21-255, His-PDI-Tag
Artikelnummer: USB-583479
Hersteller Artikelnummer: 583479
Alternativnummer: USB-583479-20,USB-583479-100
Hersteller: US Biological
Kategorie: Molekularbiologie
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Source: Recombinant protein corresponding to aa21-255 from human Acetylcholine receptor subunit alpha, fused to 6X His-PDI-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~86.0kD Amino Acid Sequence: SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 86
UniProt: P02708
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.