Acetylcholine Receptor Subunit Alpha, Recombinant, Tetronarce Californica, aa25-234, His-Tag

Artikelnummer: USB-583480
Artikelname: Acetylcholine Receptor Subunit Alpha, Recombinant, Tetronarce Californica, aa25-234, His-Tag
Artikelnummer: USB-583480
Hersteller Artikelnummer: 583480
Alternativnummer: USB-583480-20,USB-583480-100
Hersteller: US Biological
Kategorie: Molekularbiologie
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Source: Recombinant protein corresponding to aa25-234 from Tetronarce californica Acetylcholine receptor subunit alpha, fused to 10X His-Tag at N-terminal, expressed in Mammalian cell. Molecular Weight: ~28.4kD Amino Acid Sequence: SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 28.4
UniProt: P02710
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.