Activin 2, Recombinant, Schmidtea Mediterranea, aa64-406, His-Tag

Artikelnummer: USB-583506
Artikelname: Activin 2, Recombinant, Schmidtea Mediterranea, aa64-406, His-Tag
Artikelnummer: USB-583506
Hersteller Artikelnummer: 583506
Alternativnummer: USB-583506-20,USB-583506-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa64-406 from Schmidtea mediterranea Activin 2, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~42.9kD Amino Acid Sequence: NPVERKSSVYNDNAEEKIIQKDSFKDKVINDLKSKILQKLNLKEAPKFNSSFDWSSMTEQIRSAALRLGVPFDETTENSQPTSESMIISLTKVNHCIDNSTNNQHCYDLTIPNMDNKILVGANFIIQFLPLAFERTVEDNIIYNITINNLPETVYSFSVAQLKSNSLYIAYTNILKTLLDNQRMSHSTFSFTVSISGDEQTTKLERMIDIENIVIELEYQVLPTPVRKRRDAGNTCIPNTYFCCTQTLKVGIDELGWSQFIFAPTTFTINYCRGDCNSYLTFSSNHARALNFARGRGLGSNKDLRACCVPYSYSSLTIMYLNNENALEVSTFNDLIAATCGCM Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 42.9
UniProt: U3RAB9
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.