Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosaMine O-acyltransferase, Recombinant, Neisseria Meningitidis Serogroup C, aa1-258, His-Tag

Artikelnummer: USB-583509
Artikelname: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosaMine O-acyltransferase, Recombinant, Neisseria Meningitidis Serogroup C, aa1-258, His-Tag
Artikelnummer: USB-583509
Hersteller Artikelnummer: 583509
Alternativnummer: USB-583509-20,USB-583509-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Involved in the biosynthesis of lipid A, a phosphorylated glycolipid that anchors the lipopolysaccharide to the outer membrane of the cell. Source: Recombinant protein corresponding to aa1-258 from Neisseria meningitidis serogroup C Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, fused to 10X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~34.2kD Amino Acid Sequence: MTLIHPTAVIDPKAELDSSVKVGAYTVIGPNVQIGANTEIGPHAVINGHTSIGENNRIFQFASLGEIPQDKKYRDEPTRLIIGNGNTIREFTTFNLGTVTGIGETRIGDDNWIMAYCHLAHDCVVGNHTIFANNASLAGHVTIGDYVVLGGYTLVFQFCRIGDYAMTAFAAGVHKDVPPYFMASGYRAEPAGLNSEGMRRNGFTAEQISAVKDVYKTLYHRGIPFEEAKADILRRAETQAELAVFRDFFAQSARGIIR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 34.2
UniProt: A9M3T0
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.