Acyl-CoA-binding Protein, Recombinant, Mouse, aa2-87, His-Tag, Myc-Tag

Artikelnummer: USB-583514
Artikelname: Acyl-CoA-binding Protein, Recombinant, Mouse, aa2-87, His-Tag, Myc-Tag
Artikelnummer: USB-583514
Hersteller Artikelnummer: 583514
Alternativnummer: USB-583514-20,USB-583514-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor. Source: Recombinant protein corresponding to aa1-346 from mouse Acyl-CoA-binding protein, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~16.9kD Amino Acid Sequence: SQAEFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKESAMKTYVEKVDELKKKYGI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 16.9
UniProt: P31786
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.