Acyl-CoA-binding Protein, Recombinant, Saccharomyces cerevisiae, aa1-87

Artikelnummer: USB-583516
Artikelname: Acyl-CoA-binding Protein, Recombinant, Saccharomyces cerevisiae, aa1-87
Artikelnummer: USB-583516
Hersteller Artikelnummer: 583516
Alternativnummer: USB-583516-20,USB-583516-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Its precise biological substrate is not known. Catalyzes C14-demethylation of lanosterol, 24,25-dihydrolanosterol and obtusifoliol which is critical for ergosterol biosynthesis. It transforms lanosterol into 4,4-dimethyl cholesta-8,14,24-triene-3-beta-ol. Source: Recombinant protein corresponding to aa1-451 from Saccharomyces cerevisiae Acyl-CoA-binding protein, expressed in Yeast. Molecular Weight: ~10.1kD Amino Acid Sequence: MVSQLFEEKAKAVNELPTKPSTDELLELYALYKQATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQEDAEKEYIALVDQLIAKYSS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 10.1
UniProt: P31787
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.