Adenylate Kinase, Recombinant, Mycobacterium tuberculosis, aa1-181, His-SUMO-Tag

Artikelnummer: USB-583522
Artikelname: Adenylate Kinase, Recombinant, Mycobacterium tuberculosis, aa1-181, His-SUMO-Tag
Artikelnummer: USB-583522
Hersteller Artikelnummer: 583522
Alternativnummer: USB-583522-20,USB-583522-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism. Source: Recombinant protein corresponding to aa1-181 from Mycobacterium tuberculosis Adenylate kinase, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~36.1kD Amino Acid Sequence: MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALGK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 36.1
UniProt: A5U0B9
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.