Adrenodoxin, Mitochondrial, Recombinant, Bovine, aa59-186, His-Tag

Artikelnummer: USB-583530
Artikelname: Adrenodoxin, Mitochondrial, Recombinant, Bovine, aa59-186, His-Tag
Artikelnummer: USB-583530
Hersteller Artikelnummer: 583530
Alternativnummer: USB-583530-20, USB-583530-200
Hersteller: US Biological
Kategorie: Molekularbiologie
Essential for the synthesis of various steroid hormones, participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis. Transfers electrons from adrenodoxin reductase to CYP11A1, a cytochrome P450 that catalyzes cholesterol side-chain cleavage (By similarity). Source: Recombinant protein corresponding to aa59-186 from bovine Adrenodoxin, mitochondrial, fused to 10X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~19.5kD Amino Acid Sequence: SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARESIDMGMNSSKIE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 19.5
UniProt: P00257
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.