ALK and LTK Ligand 1, Recombinant, Human, aa28-129, His-Tag, Myc-Tag

Artikelnummer: USB-583540
Artikelname: ALK and LTK Ligand 1, Recombinant, Human, aa28-129, His-Tag, Myc-Tag
Artikelnummer: USB-583540
Hersteller Artikelnummer: 583540
Alternativnummer: USB-583540-20
Hersteller: US Biological
Kategorie: Molekularbiologie
Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK, activation of ALK is reported conflictingly. Source: Recombinant protein corresponding to aa28-129 from human ALK and LTK ligand 1, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~15.4kD Amino Acid Sequence: RPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 15.4
UniProt: Q6UXT8
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.