All1616 Protein, Recombinant, Nostoc sp., aa1-227, His-Tag

Artikelnummer: USB-583545
Artikelname: All1616 Protein, Recombinant, Nostoc sp., aa1-227, His-Tag
Artikelnummer: USB-583545
Hersteller Artikelnummer: 583545
Alternativnummer: USB-583545-20,USB-583545-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa1-227 from Nostoc sp. All1616 protein, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~31.9kD Amino Acid Sequence: MRWVDDSYLLPAAKGLMSTSVPNTYAKLAKALLINYSFDLSGYHVDELVNRWQKQYPADWLHLAVIEALYQGRYKAISVQQLLAFWQRRGQEIYHFNMEFERLICSKFPESLTPMAASEQYSRQGKNQNQTLQLMSFKQQEQVKEEEEPPTEKMLALSSTSVTASIEVSVSQQEDYLGQPFSLNPDISTKLLPISVTHPPIGQFTPQTSDRSESFTSKLKAISNENS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 31.9
UniProt: Q8YWJ7
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.