Alpha-2-macroglobulin Receptor-associated Protein, Recombinant, Mouse, aa248-360, His-Tag, Myc-Tag

Artikelnummer: USB-583569
Artikelname: Alpha-2-macroglobulin Receptor-associated Protein, Recombinant, Mouse, aa248-360, His-Tag, Myc-Tag
Artikelnummer: USB-583569
Hersteller Artikelnummer: 583569
Alternativnummer: USB-583569-20,USB-583569-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Molecular chaperone for LDL receptor-related proteins that may regulate their ligand binding activity along the secretory pathway. Source: Recombinant protein corresponding to aa248-360 from mouse Alpha-2-macroglobulin receptor-associated protein, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~19.4kD Amino Acid Sequence: GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 19.4
UniProt: P55302
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.