Alpha-2-macroglobulin Receptor-associated Protein(Lrpap1), Recombinant, Mouse, aa248-360, GFP-Tag, His-Tag

Artikelnummer: USB-583572
Artikelname: Alpha-2-macroglobulin Receptor-associated Protein(Lrpap1), Recombinant, Mouse, aa248-360, GFP-Tag, His-Tag
Artikelnummer: USB-583572
Hersteller Artikelnummer: 583572
Alternativnummer: USB-583572-20, USB-583572-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Molecular chaperone for LDL receptor-related proteins that may regulate their ligand binding activity along the secretory pathway. Source: Recombinant protein corresponding to aa42-288 from human Testisin, fused to GFP-Tag at N-terminal and 6X His-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~43.4kD Amino Acid Sequence: IVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 43.4
UniProt: P55302
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.