Alpha-amylase Inhibitor HOE-467A, Recombinant, Streptomyces Tendae, aa31-104, His-SUMO-Tag, Myc-Tag

Artikelnummer: USB-583573
Artikelname: Alpha-amylase Inhibitor HOE-467A, Recombinant, Streptomyces Tendae, aa31-104, His-SUMO-Tag, Myc-Tag
Artikelnummer: USB-583573
Hersteller Artikelnummer: 583573
Alternativnummer: USB-583573-20,USB-583573-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Inhibits mammalian alpha-amylases specifically but has no action on plant and microbial alpha-amylases. Forms a tight stoichiometric 1:1 complex with alpha-amylase. Source: Recombinant protein corresponding to aa31-104 from Alpha-amylase inhibitor HOE-467A Alpha-amylase inhibitor HOE-467A, fused to 10X His-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~28.0kD Amino Acid Sequence: DTTVSEPAPSCVTLYQSWRYSQADNGCAQTVTVKVVYEDDTEGLCYAVAPGQITTVGDGYIGSHGHARYLARCL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 28
UniProt: P01092
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.