Alpha-crystallin, Recombinant, Mycobacterium bovis, aa2-144, His-Tag

Artikelnummer: USB-583576
Artikelname: Alpha-crystallin, Recombinant, Mycobacterium bovis, aa2-144, His-Tag
Artikelnummer: USB-583576
Hersteller Artikelnummer: 583576
Alternativnummer: USB-583576-20,USB-583576-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Acts as a chaperone. Source: Recombinant protein corresponding to aa2-144 from Mycobacterium bovis Alpha-crystallin, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~20.1kD Amino Acid Sequence: ATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 20.1
UniProt: P0A5B8
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.