Alpha-insect Toxin BjaIT, Recombinant, Hottentotta Judaicus, aa20-83, His-Tag, Myc-Tag

Artikelnummer: USB-583582
Artikelname: Alpha-insect Toxin BjaIT, Recombinant, Hottentotta Judaicus, aa20-83, His-Tag, Myc-Tag
Artikelnummer: USB-583582
Hersteller Artikelnummer: 583582
Alternativnummer: USB-583582-20
Hersteller: US Biological
Kategorie: Molekularbiologie
Binds voltage-dependently at site-3 of sodium channels and inhibits the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin is active against insects (para/tipE). Source: Recombinant protein corresponding to aa20-83 from Hottentotta judaicus Alpha-insect toxin BjaIT, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~10.8kD Amino Acid Sequence: GRDAYIADNLNCAYTCGSNSYCNTECTKNGAVSGYCQWLGKYGNACWCINLPDKVPIRIPGACR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 10.8
UniProt: Q56TT9
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.