Alpha-like Toxin Lqh7, Recombinant, Leiurus hebraeus, aa1-66, His-Tag

Artikelnummer: USB-583588
Artikelname: Alpha-like Toxin Lqh7, Recombinant, Leiurus hebraeus, aa1-66, His-Tag
Artikelnummer: USB-583588
Hersteller Artikelnummer: 583588
Alternativnummer: USB-583588-20,USB-583588-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin is highly toxic to insects and mice, and inhibits the binding of alpha-toxin to cockroach neuronal membranes. Source: Recombinant protein corresponding to aa1-66 from Leiurus hebraeus Alpha-like toxin Lqh7, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~8.8kD Amino Acid Sequence: VRDGYIAKPENCAHHCFPGSSGCDTLCKENGGTGGHCGFKVGHGTACWCNALPDKVGIIVDGVKCH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 8.8
UniProt: P59357
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.