Alpha-like Toxin Lqh7, Recombinant, Leiurus Hebraeus, aa1-66, His-Tag, Myc-Tag

Artikelnummer: USB-583589
Artikelname: Alpha-like Toxin Lqh7, Recombinant, Leiurus Hebraeus, aa1-66, His-Tag, Myc-Tag
Artikelnummer: USB-583589
Hersteller Artikelnummer: 583589
Alternativnummer: USB-583589-20
Hersteller: US Biological
Kategorie: Molekularbiologie
Binds to sodium channels (Nav) and inhibits the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin is highly toxic to insects and mice, and inhibits the binding of alpha-toxin to cockroach neuronal membranes. Source: Recombinant protein corresponding to aa1-66 from Leiurus hebraeus Alpha-like toxin Lqh7, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~10.7kD Amino Acid Sequence: VRDGYIAKPENCAHHCFPGSSGCDTLCKENGGTGGHCGFKVGHGTACWCNALPDKVGIIVDGVKCH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 10.7
UniProt: P59357
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.