Angiopoietin-like Protein 8, Recombinant, Human, aa22-198, His-Tag

Produktübersicht

• Artikelname: Angiopoietin-like Protein 8, Recombinant, Human, aa22-198, His-Tag
• Artikelnummer: USB-583616
• Hersteller Artikelnummer: 583616
• Alternativnummer: USB-583616-20, USB-583616-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Hormone that acts as a blood lipid regulator by regulating serum triglyceride levels. Source: Recombinant protein corresponding to human Angiopoietin-like protein 8, fused to 10X His-Tag at N-terminal, expressed in Baculovirus. Molecular Weight: ~22.4kD Amino Acid Sequence: APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 22.4
• UniProt: Q6UXH0
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.