Anterior Gradient Protein 2 Homolog, Recombinant, Mouse, aa21-175, His-Tag

Artikelnummer: USB-583630
Artikelname: Anterior Gradient Protein 2 Homolog, Recombinant, Mouse, aa21-175, His-Tag
Artikelnummer: USB-583630
Hersteller Artikelnummer: 583630
Alternativnummer: USB-583630-20,USB-583630-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Required for MUC2 post-transcriptional synthesis and secretion. May play a role in the production of mucus by intestinal cells. Proto-oncogene that may play a role in cell migration, cell differentiation and cell growth. Promotes cell adhesion. Source: Recombinant protein corresponding to aa21-175 from mouse Anterior gradient protein 2 homolog, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~19.9kD Amino Acid Sequence: KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 19.9
UniProt: O88312
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.