Apolipoprotein B-100, Recombinant, Human, aa28-127, His-Tag

Artikelnummer: USB-583654
Artikelname: Apolipoprotein B-100, Recombinant, Human, aa28-127, His-Tag
Artikelnummer: USB-583654
Hersteller Artikelnummer: 583654
Alternativnummer: USB-583654-20,USB-583654-100,USB-583654-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor. Partial recombinant protein corresponding to aa28-127 from human Apolipoprotein B-100, fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Uniprot/Accession: P04114 Molecular Weight: ~27.2kD Amino Acid Sequence: EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 27.2
UniProt: P04114
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from PBS, pH 7.4, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.