Apolipoprotein D, Recombinant, Mouse, aa21-189, His-Tag, Myc-Tag

Artikelnummer: USB-583663
Artikelname: Apolipoprotein D, Recombinant, Mouse, aa21-189, His-Tag, Myc-Tag
Artikelnummer: USB-583663
Hersteller Artikelnummer: 583663
Alternativnummer: USB-583663-20, USB-583663-100
Hersteller: US Biological
Kategorie: Molekularbiologie
APOD occurs in the macromolecular complex with lecithin-transport and binding of bilin. Appears to be able to transport a variety of ligands in a number of different contexts. Source: Recombinant protein corresponding to aa21-189 from mouse Apolipoprotein D, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~26.9kD Amino Acid Sequence: QNFHLGKCPSPPVQENFDVKKYLGRWYEIEKIPASFEKGNCIQANYSLMENGNIEVLNKELSPDGTMNQVKGEAKQSNVSEPAKLEVQFFPLMPPAPYWILATDYENYALVYSCTTFFWLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTTDQANCPDFL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 26.9
UniProt: P51910
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.