Apoptosis Regulator Bcl-2, Recombinant, Human, aa2-211, His-Tag

Artikelnummer: USB-583667
Artikelname: Apoptosis Regulator Bcl-2, Recombinant, Human, aa2-211, His-Tag
Artikelnummer: USB-583667
Hersteller Artikelnummer: 583667
Alternativnummer: USB-583667-20,USB-583667-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release. Source: Recombinant protein corresponding to aa2-211 from human Apoptosis regulator Bcl-2, fused to 10X His-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~25.2kD Amino Acid Sequence: AHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 25.2
UniProt: P10415
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.